PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.LJ71G
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 815aa    MW: 94361.7 Da    PI: 8.6392
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.LJ71GgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.61.2e-14241051297
                  HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  ++++l +p+kfa +hg+    s  + l+ ++g +W+v l  +kk+++++++kGWkeF +   L+ g  v+Fk++g+++ ++ v ++
  Araip.LJ71G  24 NLKILKIPNKFALKHGSG--LSNPVFLKPPDGTRWKVCL--SKKDDQVWFEKGWKEFTQNYSLDHGCLVLFKYEGTTSSQFDVIII 105
                  55789**********755..6667***************..*********************************986665666665 PP

2B338.81.7e-12139220186
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                  ff+vl+++ + ++ rl++p      +  ++ +   ++le    rsW vk+   +k     +l++GW+ F+++n+Lk gD++vF+l++
  Araip.LJ71G 139 FFTVLIKPPHITQYRLCIPVLE--GYVDNEVK--NVKLEY-GDRSWPVKMLScNKIYTNRFLSAGWNLFAQENELKPGDVCVFELVN 220
                  8999999999999999999765..46555445..577666.77*******6654444446799*********************976 PP

3B3413.4e-1322930618100
                  --HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-SS CS
           B3  18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrks 100
                  ++ kf++++g     s  + l+ ++g +Wev+   rk+ ++++++kGW++F +   L++g  ++F+++g+s+    v++f+ks
  Araip.LJ71G 229 ISSKFTRRYGDG--LSNPMFLKPPDGTKWEVNW-TRKNEDEVWFEKGWNKFTQNYSLDDGHLILFTYHGNSQL--DVHIFDKS 306
                  8899*****755..5667***************.5888888**************************998777..99999985 PP

4B341.72e-1334742616100
                  EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-SS CS
           B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrks 100
                    ++ kf++++g     s  + l+ ++g +Wev+   rk+ ++++++kGW++F +   L++g  ++F+++g+s+    v++f+ks
  Araip.LJ71G 347 EKISSKFTRRYGDG--LSNPMFLKPPDGTKWEVNW-TRKNEDEVWFEKGWNKFTQNYSLDDGHLILFTYHGNSQL--DVHIFDKS 426
                  56999******755..5667***************.5888888**************************998777..99999985 PP

5B338.81.7e-125045662386
                  .HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
           B3  23 aeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                  ++e+++++e +k + l+    +sWevkl+  +k+s+  +l++GW+ F+++ +L  gD++vF+l++
  Araip.LJ71G 504 MKEYMIDEE-EKNVELK-IGEKSWEVKLRRcSKSSNYRYLGGGWSLFAQESELLPGDVCVFELIK 566
                  456654433.3345533.467*******66455555599***********************986 PP

6B341.13.2e-135746501797
                  E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                   +p+kfa ++g+    s  + l+ ++g +W+v l  +kk+++++++kGWkeF +   L+ g  v+Fk++g+++ ++ v ++
  Araip.LJ71G 574 KIPNKFALKYGSG--LSNPVFLKPPDGTRWKVCL--SKKDDQVWFEKGWKEFTQNYSLDHGCLVLFKYEGTTSSQFDVIII 650
                  69********755..6667***************..*********************************986665666665 PP

7B339.78.4e-13721802186
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                  ff+vl+++++ ++ +l++p      +  k+   k ++le+   rsW vk+   +k+++  +l++GW+ F+++n+Lk gD+++F+l++
  Araip.LJ71G 721 FFTVLIKPSHITQYLLSIPGLE--GYVDKEV--KYVKLEN-GDRSWPVKMLScSKTPSNRFLSAGWNLFAQENELKPGDVCIFELVN 802
                  8899999999999999998765..4654433..3688777.77*******65588888899***********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.85713108IPR003340B3 DNA binding domain
CDDcd100171.25E-1215106No hitNo description
SuperFamilySSF1019363.92E-1715106IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-1815107IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.2E-816108IPR003340B3 DNA binding domain
PfamPF023622.4E-1125103IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-14134222IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.55E-12135220IPR015300DNA-binding pseudobarrel domain
CDDcd100171.71E-11139220No hitNo description
SMARTSM010192.2E-4139225IPR003340B3 DNA binding domain
PfamPF023629.7E-10139223IPR003340B3 DNA binding domain
PROSITE profilePS508638.515139218IPR003340B3 DNA binding domain
SMARTSM010191.3E-7226306IPR003340B3 DNA binding domain
SuperFamilySSF1019365.49E-16228306IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.9E-17228306IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.914229306IPR003340B3 DNA binding domain
PfamPF023621.1E-10229305IPR003340B3 DNA binding domain
CDDcd100171.17E-11229304No hitNo description
SMARTSM010191.7E-7333426IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.7E-17346426IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-16348426IPR015300DNA-binding pseudobarrel domain
PfamPF023627.1E-11348425IPR003340B3 DNA binding domain
PROSITE profilePS5086311.914349426IPR003340B3 DNA binding domain
CDDcd100171.17E-11349424No hitNo description
Gene3DG3DSA:2.40.330.104.1E-12479570IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.61E-11480566IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0019484571IPR003340B3 DNA binding domain
PROSITE profilePS508638.656484564IPR003340B3 DNA binding domain
CDDcd100171.23E-10504566No hitNo description
PfamPF023629.9E-10505566IPR003340B3 DNA binding domain
SMARTSM010190.0057572653IPR003340B3 DNA binding domain
SuperFamilySSF1019364.51E-14574651IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-15574652IPR015300DNA-binding pseudobarrel domain
PfamPF023621.6E-10574648IPR003340B3 DNA binding domain
PROSITE profilePS5086311.378575653IPR003340B3 DNA binding domain
CDDcd100171.41E-9575651No hitNo description
Gene3DG3DSA:2.40.330.101.1E-13716804IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.1E-13717806IPR015300DNA-binding pseudobarrel domain
SMARTSM010196.7E-7721812IPR003340B3 DNA binding domain
PfamPF023622.3E-10721803IPR003340B3 DNA binding domain
CDDcd100171.20E-10721802No hitNo description
PROSITE profilePS5086311.011721815IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 815 aa     Download sequence    Send to blast
MSSHLHQGNA VMPILFFKII LKTNLKILKI PNKFALKHGS GLSNPVFLKP PDGTRWKVCL  60
SKKDDQVWFE KGWKEFTQNY SLDHGCLVLF KYEGTTSSQF DVIIIDDSEK NVTTSLSLNR  120
PREPRAREEA NKFVSNNPFF TVLIKPPHIT QYRLCIPVLE GYVDNEVKNV KLEYGDRSWP  180
VKMLSCNKIY TNRFLSAGWN LFAQENELKP GDVCVFELVN MQDLVFKKIS SKFTRRYGDG  240
LSNPMFLKPP DGTKWEVNWT RKNEDEVWFE KGWNKFTQNY SLDDGHLILF TYHGNSQLDV  300
HIFDKSASEI LYPGLNTTPT TAYKKKVAER RSSCSSLNWP KQERAQEKIS SKFTRRYGDG  360
LSNPMFLKPP DGTKWEVNWT RKNEDEVWFE KGWNKFTQNY SLDDGHLILF TYHGNSQLDV  420
HIFDKSASEI LYPGMLVLVP QPCNKRMKDK KKVAERRSSC SSLNWPKQER AQEVAMNFVS  480
DNPFFTMFIT HVHLAHYKAA VPNMKEYMID EEEKNVELKI GEKSWEVKLR RCSKSSNYRY  540
LGGGWSLFAQ ESELLPGDVC VFELIKMHPL QFKKIPNKFA LKYGSGLSNP VFLKPPDGTR  600
WKVCLSKKDD QVWFEKGWKE FTQNYSLDHG CLVLFKYEGT TSSQFDVIII DDSALEIDYS  660
SYNGNDDDDV SVQIVKEIHP YKKNKETMRG EKNVTTSLSL NWPREPRARE EANKFVSNNP  720
FFTVLIKPSH ITQYLLSIPG LEGYVDKEVK YVKLENGDRS WPVKMLSCSK TPSNRFLSAG  780
WNLFAQENEL KPGDVCIFEL VNMQDLVFKD ENVGG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1444450KRMKDKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016174373.11e-169PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLG8A2Z51e-73G8A2Z5_MEDTR; B3 domain-containing protein
STRINGGLYMA20G24268.15e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49475.12e-17B3 family protein